SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003253693.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003253693.1.23891
Domain Number 1 Region: 83-146
Classification Level Classification E-value
Superfamily BPTI-like 7.95e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0039
Further Details:      
 
Domain Number 2 Region: 41-89
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000405
Family Elafin-like 0.0027
Further Details:      
 
Domain Number 3 Region: 149-194
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000107
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 4 Region: 194-239
Classification Level Classification E-value
Superfamily Elafin-like 0.000000641
Family Elafin-like 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003253693.1.23891
Sequence length 241
Comment PREDICTED: WAP four-disulfide core domain protein 8 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MWTVRTEGGHLPLHSPTFSWRNVAFLLLLFLALEWTSALLTKKIKHKPGLCPKERLTCTT
ELPDSCNTDFDCKEYLKCCFFACQKKCMDAFQEPCMLPVRHGNCNHDAQRWYFDFKNYRC
TPFTYKGCEGNANNFLSEDACRTACMLIVKDGQCPLFPFTERKECPPSCHSDIDCPQTDK
CCESRCGFVCTRAWTVKQGFCPRKPLLCAKIDKPKCLQDEECPLVEKCCSRCGLKCMNPR
H
Download sequence
Identical sequences G1R4U3
ENSNLEP00000008215 XP_003253692.1.23891 XP_003253693.1.23891 ENSNLEP00000008215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]