SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003253695.3.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003253695.3.23891
Domain Number 1 Region: 47-78
Classification Level Classification E-value
Superfamily Elafin-like 0.0000615
Family Elafin-like 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003253695.3.23891
Sequence length 81
Comment PREDICTED: WAP four-disulfide core domain protein 10A [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MPSQTLLPVLVLCVVLLLLQAQGGYHDKKRMQKTQLSPEIKVCQQQPKLYLCKHLCESHR
DCQANNICCSTYCGNVCMSIL
Download sequence
Identical sequences G1R4V1
XP_003253695.3.23891 ENSNLEP00000008223 ENSNLEP00000008223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]