SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003254475.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003254475.1.23891
Domain Number 1 Region: 374-680
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.55e-54
Family Eukaryotic proteases 0.00064
Further Details:      
 
Domain Number 2 Region: 83-199
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.46e-33
Family Spermadhesin, CUB domain 0.00047
Further Details:      
 
Domain Number 3 Region: 240-310
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000848
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 4 Region: 194-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000288
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003254475.1.23891
Sequence length 680
Comment PREDICTED: inactive serine protease PAMR1 isoform X3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MCRECCEYDQIECVCPGKKEVVGYTIPCCRNEENECDSCLIHPGCTIFENCKSCRNGSWG
GTLDDFYVKGFYCAECRAGWYGGDCMRCGQVLRAPKGQILLESYPLNAHCEWTIHAKPGF
VIQLRFVMLSLEFDYMCQYDYVEVRDGDNRDGQIIKRVCGNERPAPIQSTGSSLHVLFHS
DGSKNFDGFHAIFEEITACSSSPCFHDGTCVLDKAGSYKCACLAGYTGQRCENLLEERNC
SDPGGPVNGYQRITGGPGLINGRHAKIGTVVSFFCNNSYVLSGNEKRTCQQNGEWSGKQP
ICIKACREPKISDLVRRRVLPMQVQSRETPLHQLYSAAFSKQKLQSAPTKKPALPFGDLP
MGYQHLHTQLQYECISPFYRRLGSSRRTCLRTGKWSGRAPSCIPICGKIENITAPKTQGL
RWPWQAAIYRRTSGVHDGSLHKGAWFLVCSGALVNERTVVVAAHCVTDLGKVTMIKTADL
KVVLGKFYRDDDRDEKTIQSLRISAIILHPNYDPILLDADIAILKLLDKARISTRVQPIC
LAASRDLSTSFQESHITVAGWNVLADVRSPGFKNDTLRSGVVSVVDSLLCEEQHEDHGIP
VSVTDNMFCASWDPTAPSDICTAETGGIAAVSFPGRASPEPRWHLMGLVSWSYDKTCSHR
LSTAFTKVLPFKDWIERNMK
Download sequence
Identical sequences XP_003254475.1.23891 ENSNLEP00000021789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]