SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003254484.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003254484.1.23891
Domain Number 1 Region: 348-500
Classification Level Classification E-value
Superfamily TRAF domain-like 2.62e-46
Family MATH domain 0.0000000247
Further Details:      
 
Domain Number 2 Region: 64-135
Classification Level Classification E-value
Superfamily RING/U-box 1.11e-18
Family RING finger domain, C3HC4 0.012
Further Details:      
 
Domain Number 3 Region: 186-287
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000000144
Family SIAH, seven in absentia homolog 0.02
Further Details:      
 
Domain Number 4 Region: 129-172
Classification Level Classification E-value
Superfamily TRAF domain-like 0.000000981
Family SIAH, seven in absentia homolog 0.01
Further Details:      
 
Weak hits

Sequence:  XP_003254484.1.23891
Domain Number - Region: 293-346
Classification Level Classification E-value
Superfamily Tropomyosin 0.0628
Family Tropomyosin 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003254484.1.23891
Sequence length 522
Comment PREDICTED: TNF receptor-associated factor 6 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MSLLNCENSCGSSQSEGDCCVAMASSCSAATKDDSVGGTASTGNLSSSFMEEIQGYDVEF
DPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPD
NFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQCHRPFQKFHINIHILK
DCPRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPI
PCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYISEVRNFQETIH
QLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNF
GMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE
ALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV
Download sequence
Identical sequences G1S8G6
ENSNLEP00000021805 ENSNLEP00000021805 XP_003254483.1.23891 XP_003254484.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]