SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003254823.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003254823.1.23891
Domain Number 1 Region: 65-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000793
Family I set domains 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003254823.1.23891
Sequence length 194
Comment PREDICTED: interleukin-18-binding protein isoform X2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MTMRHNWTPDLSPLWVLLLCVHIDTLLVRATPVSQTTTAATASVRSTKDPCPSQPPVFPA
AKQCPALEVTWPEVEVPLNGTLTLSCMACSRFPNFSILYWLGNGSFIEHLPGRLREGRTS
REHGSTGTQLCKALVLEQLTPALHSTNFSCVLVDPGQVVQHHVVLAQLWAGLRTTLPPTQ
EALPSSHSSPQQQG
Download sequence
Identical sequences G1S624
XP_003254823.1.23891 ENSNLEP00000020962 ENSNLEP00000020962

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]