SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003255840.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003255840.1.23891
Domain Number 1 Region: 559-770
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-47
Family DBL homology domain (DH-domain) 0.00054
Further Details:      
 
Domain Number 2 Region: 68-148
Classification Level Classification E-value
Superfamily F-box domain 8.76e-18
Family F-box domain 0.00093
Further Details:      
 
Domain Number 3 Region: 792-901
Classification Level Classification E-value
Superfamily PH domain-like 1.54e-17
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003255840.1.23891
Sequence length 903
Comment PREDICTED: epithelial cell-transforming sequence 2 oncogene-like [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MESFHTRFSAWTPFSNKSLNRQLFQERVALISHWFDLWTNKQRQEFLFAIFLRCTKSQLR
FVQDWFSERMQVAKVDFSTVLPRFISLYIFSFLSPKDLCAAAQVSWPWKFLTEQDCLWMP
KCIKFGWFLPYTATDNEYGAWKRHYIACVSHLDWLTPREAAATYGTLNEPKTEDEELLER
QREKCLRKRIWEKIALRKKELFKVRPPWVSGTCCSSMLKPRCQPRLSQTVRERVGLHEAL
EKQLVLTSLETLPKRSNISGSHSYPLLSKKNWHGVHKNDDSSSYALRPHFMLISSRIPAY
EMVVESVKSGVVSVVYEHSVTLESLLYLIEKALDGQKAQSMGIFSDGDSREINLLQGYKI
GIKNLLRPEVRDFWEKLGSYVATEEEGGHVDFFVPLGASEAGIEVLSQLSQLTGTFFTAP
TGIATGSYQHILSDWLGSQWGKAPSSIYFCESKLQTWSSFTDFLEETLKTVRKQLYPLFR
ELQKSISGRMIGQFMFDTMGMTNILNNQETAQALADGLMELSKEDSERNVVEDNSWDTKS
RLSKNDLNFEALINLERILQDSAEKRARVVRELLQSERKYVQMLEIVRDVYVAPLKAALS
SNRAILSAANIQIIFSDILQILSLNRQFLDNLRDRLQEWGPAHCVGEIVTKFGSQLNTYT
NFFNNYPVILKTIEKCREMIPAFRTFLKRHDKTIVTKMLSLPELLLYPSRRFEEYLNLLY
AVRLHTPAEHVDCGDLTTAIDQIEKYKGYIDQMKQNINMKDHLSDIQRIIGGCPTLSEVN
RYLIRVQDVAQLHCCDEEISLSLRLYEHIHDLSLFLFNDALLISSRGTSHTPFERTSKTT
YQFIVSVALHRLLIENIPDSKYVKNAFILQGPKYKWICATEIEDDKFLWLSVLQNAIKSS
MEK
Download sequence
Identical sequences G1RYA4
ENSNLEP00000018231 XP_003255840.1.23891 XP_003255841.1.23891 ENSNLEP00000018231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]