SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003255921.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003255921.1.23891
Domain Number 1 Region: 29-204
Classification Level Classification E-value
Superfamily MHC antigen-recognition domain 8.47e-51
Family MHC antigen-recognition domain 0.00000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003255921.1.23891
Sequence length 244
Comment PREDICTED: NKG2D ligand 1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MAAAASPAFLLCLPLLHLLSGWSRAGRADTHCLCYDFIITPKFRPEPQWCEVQGLVDERP
FLHYDCVNHKAKAFASLGKKVNVTKTWEEQTETLRDVVDFLKGQLLDIQVENLIPIEPLT
LQARMSCEHEAHGHGRGSWQFLSNGHKFLLFDSNNRKWTVLHPGAKKMKEKWEKNREVIV
FFQKVSMGDCKMWLEEFLTYWEQMLDPTKPPSLTPGTTEPKAMATTLSPWGLLIIFLCFI
LAGR
Download sequence
Identical sequences G1RZF8
ENSNLEP00000018635 XP_003255921.1.23891 ENSNLEP00000018635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]