SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003256513.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003256513.1.23891
Domain Number 1 Region: 378-572
Classification Level Classification E-value
Superfamily Fibronectin type III 1.82e-41
Family Fibronectin type III 0.0000242
Further Details:      
 
Domain Number 2 Region: 570-767
Classification Level Classification E-value
Superfamily Fibronectin type III 1.74e-40
Family Fibronectin type III 0.00016
Further Details:      
 
Domain Number 3 Region: 765-959
Classification Level Classification E-value
Superfamily Fibronectin type III 4.2e-35
Family Fibronectin type III 0.00082
Further Details:      
 
Domain Number 4 Region: 957-1130
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-27
Family Fibronectin type III 0.0035
Further Details:      
 
Domain Number 5 Region: 267-386
Classification Level Classification E-value
Superfamily Fibronectin type III 4.97e-18
Family Fibronectin type III 0.0000291
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003256513.1.23891
Sequence length 1204
Comment PREDICTED: fibronectin type III domain-containing protein 3B [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MYVTMMMTDQIPLELPPLLNGEVAMMPHLVNGDAAQQVILVQVNPGETFTIRAEDGTLQC
IQGPAEVPMMSPNGSIPPIHVPPGYISQVIEDSTGVRRVVVTPQSPECYPPSYPSAMSPT
HHLPPYLTHHPHFIHNSHTAYYPPVTGPGDMPPQFFPQHHLPHTIYGEQEIIPFYGMSSY
ITREDQYSKPPHKKLKDRQIDRQNRLNSPPSSIYKSSCTTVYNGYGKGHSGGSGGGGSGG
GPGIKKTERRARSSPKSNDSDLQEYELEVKRVQDILSGIEKPQVSNIQARAVVLSWAPPV
GLSCGPHSGLSFPYSYEVALSDKGRDGKYKIIYSGEELECNLKDLRPATDYHVRVYAMYN
SVKGSCSEPVSFTTHSCAPECPFPPKLAHRSKSSLTLQWKAPIDNGSKITNYLLEWDEGK
RNSGFRQCFFGSQKHCKLTKLCPAMGYTFRLAARNDIGTSGYSQEVVCYTLGNIPQMPSA
PRLVRAGITWVMLQWSKPEGCSPEEVITYTLEIQEDENDNLFHPKYTGEDLTCTVKNLKR
STQYKFRLTASNTEGKSCPSEVLVCTTSPDRPGPPTRPLVKGPVTSHGFSVKWDPPKDNG
GSEILKYLLEITDGNSEANQWEVAYSGSATEYTFTHLKPGTLYKLRACCISTGGHSQCSE
SLPVRTLSIAPGQCRPPRVLGRPKHKEVHLEWDVPASESGCEVSEYSVEMTEPEDVASEV
YHGPELECTVGNLLPGTVYRFRVRALNDGGYGPYSDVSEITTAAGPPGQCRAPCISCTPD
GCILVSWESPDSSGADISEYRLEWGEDEESLELIYHGTDTRFEIRDLLPAAQYCCRLQAL
NQAGAGPYSELVLCQTPASAPDPVSTLCVLEEEPLDAYPDSPSACLVLNWEEPCNNGSEI
LAYNIDLGDTSITVGNTTIHVMKDLLPETTYRIRIQAINEIGAGPFSQFIKAKTRPLPPL
PPRLECAAAGPQSLKLKWGDSNSKTHAADDMVYTLQLEDRNKRFISIYRGPSHTYKVQRL
TEFTCYSFRIQAASEAGEGPFSETYTFSTTKSVPPTIKAPRVTQLEGNSCEILWETVPPM
KGDPVNYILQVLVGRESEYKQVYKGEEATFQISGLQTNTDYRFRVCACRRCLDTSQELSG
AFSPSAAFVLQQSEVMLTGDMGSLDDPKMKSMMPTDEQFAAIIVLGFATLSILFAFILQY
FLMK
Download sequence
Identical sequences G1R0H8
ENSNLEP00000006699 XP_003256512.1.23891 XP_003256513.1.23891 ENSNLEP00000006699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]