SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003258920.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003258920.1.23891
Domain Number 1 Region: 3-246
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.24e-53
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0052
Further Details:      
 
Domain Number 2 Region: 311-484
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000363
Family FAD/NAD-linked reductases, N-terminal and central domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003258920.1.23891
Sequence length 558
Comment PREDICTED: dimethylaniline monooxygenase [N-oxide-forming] 4 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MAKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSTDGMTRVYKSLVT
NVCKEMSCYSDFPFHEDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKHPDFS
ATGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPE
GFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCC
SFIAQLLPSRFLNWIQERKLNKKFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKT
SVMEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIFLYKHVFPVNL
ERATLAIIGLISLKGSILSGTELQARWVTRVFKGLCKIPPSQKLMMEATEKEQLIKRGVF
KDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLVGPGKWD
GARNAILTQWDRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLASFLLICKSSLFLKLV
RDKLQDRMSPYLVSLWRG
Download sequence
Identical sequences G1RYU9
ENSNLEP00000018426 ENSNLEP00000018426 ENSNLEP00000023842 XP_003258920.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]