SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003259592.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003259592.1.23891
Domain Number 1 Region: 47-314
Classification Level Classification E-value
Superfamily L domain-like 2.55e-57
Family Ngr ectodomain-like 0.0016
Further Details:      
 
Domain Number 2 Region: 230-477
Classification Level Classification E-value
Superfamily RNI-like 4.24e-42
Family Cyclin A/CDK2-associated p19, Skp2 0.017
Further Details:      
 
Domain Number 3 Region: 547-848
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 6.5e-33
Family Rhodopsin-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003259592.1.23891
Sequence length 907
Comment PREDICTED: leucine-rich repeat-containing G-protein coupled receptor 5 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MDTSRLGVLLSLLVLLQLAAGGSSPRSGALLRGCPTHCHCEPDGRMLLRVDCSDLGLSEL
PSNLSVFTSYLDLSMNNISQLLPNPLPSLRFLEELRLAGNALTYIPKGAFTGLYSLKVLM
LQNNQLRQVPTEALQNLRSLQSLRLDANHISYVPPSCFSGLHSLRHLWLDDNALTEIPVQ
AFRSLSALQAMTLALNKIHHIPDYAFGNLSSLVVLHLHNNRIHSLGKKCFDGLHSLETLD
LNYNNLDEFPTAIRTLSNLKELGFHSNNIRSIPEKAFVGNPSLITIHFYDNPIQFVGRSA
FQHLPELRTLTLNGASQITEFPDLTETANLESLTLTGAQISSLPQTVCNQLPNLQVLDLS
YNLLEDLPSFSVCQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPSAFST
LPSLIKLDLSSNLLSSFPVTGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCC
AFGVCENAYKISNQWNKGDNSSMDDFHKKDAGMFQVQDERDLEDFLLDFEEDLKALHSVQ
CSPSPGPFKPCEHLLDGWLIRIGVWTIAVLALTCNALVTSTVFRSPLYISAIKLLIGVIA
AVNMLTGVSSAVLAGVDAFTFGSFARHGAWWENGVGCQVIGFLSIFASESSVFLLTLAAL
ERGFSVKCSAKFETKAPFSSLKVIILLCALLALTMAAVPLLGGSEYGASPLCLPLPFGEP
STTGYMVALILLNSLCFLMMTIAYTKLYCNLDKGDLENIWDCSMVKHIALLLFTNCILYC
PVAFLSFSSLLNLTFISPEVIKFILLVVVPLPACLNPLLYILFNPHFKEDLVSLGKQTYF
WTRSKHPSLMSINSDDVEKQSCDSTQALVTFTSSSIAYDLPPSSVPSPAYPVTENCHLSS
VAFVPCL
Download sequence
Identical sequences A0A2I3HQ88
XP_003259592.1.23891 ENSNLEP00000005285 ENSNLEP00000005285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]