SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003259672.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003259672.1.23891
Domain Number 1 Region: 522-734
Classification Level Classification E-value
Superfamily TPR-like 4.55e-31
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Domain Number 2 Region: 428-538
Classification Level Classification E-value
Superfamily TPR-like 8.01e-16
Family Tetratricopeptide repeat (TPR) 0.0042
Further Details:      
 
Domain Number 3 Region: 720-811
Classification Level Classification E-value
Superfamily TPR-like 0.00000000493
Family Tetratricopeptide repeat (TPR) 0.027
Further Details:      
 
Weak hits

Sequence:  XP_003259672.1.23891
Domain Number - Region: 179-248
Classification Level Classification E-value
Superfamily SIS domain 0.0145
Family double-SIS domain 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003259672.1.23891
Sequence length 914
Comment PREDICTED: transmembrane and TPR repeat-containing protein 3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MADINLKEITLIVGVVTACYWNSLFCGFVFDDVSAILDNKDLHPSTPLKTLFQNDFWGTP
MSEERSHKSYRPLTVLTFRLNYLLSELKPMSYHLLNMIFHAVVSVIFLKVCKLFLDNKSS
VIASLLFAVHPIHTEAVTGVVGRAELLSSIFFLAAFLSYTRSKGPDNSIIWTPIALTVFL
VAVATLCKEQGITVVGICCVYEVFIAQGYTLPLLYTTAGQFLRGKGSIPFSMLQTLVKLI
VLMFSTLLLVVIRVQVIQSQLPVFTRFDNPAAVSPTPTRQLTFNYLLPVNAWLLLNPSEL
CCDWTMGTIPLIESLLDIRNLATFTFFCFLGTLGVFSIRYSGDSSKTVLMALCLMALPFI
PASNLFFPVGFVVAERVLYVPSMGFCILVAHGWQKISTKSVFKKLSWICLSMVILTHSLK
TFHRNWDWESEYTLFMSALKVNKNNAKLWNNVGHALENEKNFERALKYFLQATHVQPDDI
GAHMNVGRTYKNLNRTKEAEESYMMAKSLMRQIIPGKKYAARIAPNHLNVYINLANLIRA
NESRLEEADQLYRQAISMRPDFKQAYISRGELLLKMNKPLKAKEAYLKALELDRNNADLW
YNLAIVHIELKEPNEALRNFNRALELNPKHKLALFNSAIVMQESGEVKLRPEARKRLLSY
INEEPLDANGYFNLGMLAMDDKKDNEAEIWMKKAIKLQADFRSALFNLALLYSQTAKELK
ALPILEELLRYYPDHIKGLILKGDILMNQKKDILGAKKCFERILEMDPSNVQGKHNLCVV
YFEEKDLLKAERCLLETLALAPHEEYIQRHLNIVRDKISSSSFIEPIFPTSKFSSVEGKK
IPTESVKEIRGESRQTQIVKTSDNKSQSKSSKQLGKNGDEETPHKTTKDIKEIEKKRVAA
LKRLEEIERILNGE
Download sequence
Identical sequences G1R0B0
XP_003259672.1.23891 ENSNLEP00000006631 ENSNLEP00000006631

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]