SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003259716.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003259716.1.23891
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily DEATH domain 1.18e-23
Family Caspase recruitment domain, CARD 0.00000659
Further Details:      
 
Domain Number 2 Region: 110-191
Classification Level Classification E-value
Superfamily DEATH domain 5e-20
Family DEATH domain, DD 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003259716.1.23891
Sequence length 199
Comment PREDICTED: death domain-containing protein CRADD [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHVQEINAQTTGLRKTMLLLDI
LPSRGPKAFDAFLDSLQEFPWVREKLKKAREEVMTDLPAGDRLTGIPLHILNSSPSDRQI
NQLAQRLGPEWEPVVLSLGLSQTDIYRCKANHPHNVQSQVVEALVRWRQRFGKQATFQSL
HNGLQAVEVDPSLLLHMLE
Download sequence
Identical sequences A0A2I3H981
XP_003259716.1.23891 XP_003259717.1.23891 ENSNLEP00000006922 ENSNLEP00000006922 ENSNLEP00000024416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]