SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003262360.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003262360.1.23891
Domain Number 1 Region: 478-608
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 7.69e-55
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.00000017
Further Details:      
 
Domain Number 2 Region: 128-348
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.08e-37
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000000478
Further Details:      
 
Domain Number 3 Region: 299-475
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.43e-21
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003262360.1.23891
Sequence length 613
Comment PREDICTED: apoptosis-inducing factor 1, mitochondrial isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPGNLFQRWHVPLELQMTRQMASSGAS
GGKIDNSVLVLIVGLSTVGAGAYAYKTIKEDEKRYNERISGLGLTPEQKQKKAALSASEG
EEVPQDRAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELW
FSDDPNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRD
NMVKLNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREV
KSITIIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREG
VKVMPNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGG
FRVNAELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQS
MFWSDLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASE
ITLPPSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHED
LNEVAKLFNIHED
Download sequence
Identical sequences G1RZ98
XP_003262360.1.23891 ENSNLEP00000018575 ENSNLEP00000018575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]