SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003262451.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003262451.1.23891
Domain Number 1 Region: 218-334
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-16
Family Growth factor receptor domain 0.018
Further Details:      
 
Domain Number 2 Region: 149-259
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000361
Family Growth factor receptor domain 0.01
Further Details:      
 
Weak hits

Sequence:  XP_003262451.1.23891
Domain Number - Region: 333-376
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00042
Family EGF-type module 0.018
Further Details:      
 
Domain Number - Region: 40-71
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000742
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003262451.1.23891
Sequence length 493
Comment PREDICTED: EGF-containing fibulin-like extracellular matrix protein 1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MLKALFLTMLTLALVKSQDTEETITYTQCTDGYEWDPVRQQCKDIDECDIVPDACKGGMK
CVNHYGGYLCLPKTAQIIVNNEQPQQETPPAEGTSGATTGVVAASSMASSGVLPGGGFVA
SAAAVAGPEVQTGRNNFVIRRNPADPQRIPSNPSHRIQCAAGYEQSEHNVCQDIDECTAG
THNCRADQVCINLRGSFACQCPPGYQKRGEQCVDIDECTIPPYCHQRCVNTPGSFYCQCS
PGFQLAANNYTCVDINECDASNQCAQQCYNILGSFICQCNQGYELSSDRLNCEDIDECRT
SSYLCQYQCVNEPGKFSCMCPQGYQVVRSRTCQDINECETTNECREDEMCWNYHGGFRCY
PRNPCQDPYILTPENRCVCPVSNAMCRELPQSIVYKYMSIRSDRSVPSDIFQIQATTIYA
NTINTFRIKSGNENGEFYLRQTSPVSAMLVLVKPLSGPREHIVDLEMLTVSSIGTFRTSS
VLRLTIIVGPFSF
Download sequence
Identical sequences G1RE04
ENSNLEP00000011454 XP_003262450.1.23891 XP_003262451.1.23891 ENSNLEP00000011454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]