SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003262922.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003262922.1.23891
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 3.79e-68
Family TRADD, N-terminal domain 0.0000000462
Further Details:      
 
Domain Number 2 Region: 220-304
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000000016
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003262922.1.23891
Sequence length 311
Comment PREDICTED: tumor necrosis factor receptor type 1-associated DEATH domain protein [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MAAGQNGHEEWVGSAYLFVESSLDKVVLSDAYAHPQQKVAVYRALQAALAESGGSPDVLQ
MLKIHRSDPQLIVQLRFCGRQPCGRFLRAYREGALRAALQRSLAAALAQRSVPLQLELRA
GAERLDALLADEERCLSCILAQQPDRLRDEELAELEDALRNLKCGSGAQGGDGEVASAPL
QPPVPSLSEAKPPPPPPAQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
RALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAEDL
LGLTDPNGGLA
Download sequence
Identical sequences G1QWB5
ENSNLEP00000023448 XP_003262922.1.23891 XP_012360577.1.23891 ENSNLEP00000005236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]