SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003263582.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003263582.1.23891
Domain Number 1 Region: 20-131
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000189
Family I set domains 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003263582.1.23891
Sequence length 205
Comment PREDICTED: CD83 antigen isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MSRGLQLLLLSCAYSLAPAMPEVKVACSEDVNLPCTAPWDPQVPYTVSWVKLLEGGEERM
ETPQEDHLRGQHYHQKGQNGSFDAPNEMPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSG
KVILRVTGCPAQRKEETFKKYRAEIVLLLALVIFYLTLIIFTCKFARLQSIFPDFSKAGM
ERAFLPVTSPNKHLGPVTLHKTELV
Download sequence
Identical sequences G1QJJ5
ENSNLEP00000001090 XP_003263582.1.23891 ENSNLEP00000001090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]