SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003263916.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003263916.1.23891
Domain Number 1 Region: 97-212
Classification Level Classification E-value
Superfamily Fibronectin type III 7.81e-31
Family Fibronectin type III 0.0032
Further Details:      
 
Domain Number 2 Region: 21-120
Classification Level Classification E-value
Superfamily Fibronectin type III 9.84e-21
Family Fibronectin type III 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003263916.1.23891
Sequence length 325
Comment PREDICTED: interleukin-10 receptor subunit beta isoform X2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MARSLGSWLGGCLLVSALGMVPPPENVRMNSVNFKNLLQWESPAFAKGNLTFTAQYLSYR
IFQDKCMSTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQV
EVLADSLHMRFLAPKIENEYETWTMRNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRN
LEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTNDETVPSWMVAVILMASVFVVCLALLG
CFALLWCVYKKTKYAFSPRNSLPQHLKEFLGHPHHNTLLFFSFPLSDENDVFDKLSVIAE
DSESGKQNPGDSCSLGTPPGQGPQS
Download sequence
Identical sequences G1QUL2
ENSNLEP00000004632 ENSNLEP00000004632 XP_003263916.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]