SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003264546.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003264546.1.23891
Domain Number 1 Region: 530-592
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.1e-19
Family Complement control module/SCR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 473-532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000756
Family Complement control module/SCR domain 0.00085
Further Details:      
 
Domain Number 3 Region: 229-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000852
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 4 Region: 290-346
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000162
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 5 Region: 411-466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000108
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 6 Region: 169-226
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000123
Family Complement control module/SCR domain 0.0028
Further Details:      
 
Domain Number 7 Region: 109-166
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000472
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 8 Region: 47-111
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000103
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Weak hits

Sequence:  XP_003264546.1.23891
Domain Number - Region: 353-405
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00107
Family Complement control module/SCR domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003264546.1.23891
Sequence length 593
Comment PREDICTED: complement factor H-related protein 5 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKADLKQHHHHWSIFSYIRLRLPSMLLLFSVILISWVSTVGGEATFCDFPKIHHGFLYDE
ENYKPFSQVPTGEVFYYSCEYNFVSPSKSFWTRITCTEEGWSPTPKCLRQCFFPFVENGH
SESSGRIHLEGDTVQIICNTGYSLQNNEKNISCVERGWSTPPKCSFTKKECHVPILEANV
DVQPKKESYEVGDVLKFSCKKKNTRVGPDSVQCYQFGWSPNFPTCKGQVRSCGPPPHLSN
GEVKEIRKEEYGHNEVVEYDCNPNFIINGPKKIQCVDGEWTTLPTCVEQVKTCGYIPELE
YGYVQPSVPPYQHGVSVEVNCRNEYTMIGNNMITCINGIWTELPVCVATHQLQRCKIAGI
NIKTLFKPSGNEFNHNARIRYRCLDIFRYRHSVCINGKWNPKLDCTEKREKFCPPPPQIP
NAQNMTTTVNYQDGEKVAVLCKENYRLPEAKEIVCNNGRWKSLPRCVESTAYCGPPPSIN
NGDITSFPLSVYPPGSTVMYRCQSFYKLQGSVNVTCRNKQWSEPPRCLDPCVVSEENMNK
NNIQLKWRNNGKLYAKTGDAIEFQCKFLYKAKISSPSFRAICQEGKFEYPICE
Download sequence
Identical sequences ENSNLEP00000021935 XP_003264546.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]