SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003264622.2.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003264622.2.23891
Domain Number 1 Region: 81-150
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 2.22e-17
Family HLH, helix-loop-helix DNA-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003264622.2.23891
Sequence length 224
Comment PREDICTED: myogenin [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEH
CPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVE
ILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFS
ANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Download sequence
Identical sequences A0A2J8QWJ8 H2N443 P15173
ENSPPYP00000000374 ENSGGOP00000002081 GO.37161 HR4693 ENSGGOP00000002081 ENSP00000241651 ENSPPYP00000000374 ENSP00000241651 ENSP00000241651 gi|18765727|ref|NP_002470.2| 9600.ENSPPYP00000000374 9606.ENSP00000241651 NP_002470.2.87134 NP_002470.2.92137 XP_003264622.2.23891 XP_003823047.2.60992 XP_004028233.1.27298 ENSNLEP00000021999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]