SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003264755.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003264755.1.23891
Domain Number 1 Region: 25-127
Classification Level Classification E-value
Superfamily Fibronectin type III 3.04e-37
Family Fibronectin type III 0.000000954
Further Details:      
 
Domain Number 2 Region: 240-326
Classification Level Classification E-value
Superfamily Fibronectin type III 1.02e-30
Family Fibronectin type III 0.0000176
Further Details:      
 
Domain Number 3 Region: 128-240
Classification Level Classification E-value
Superfamily Fibronectin type III 4.37e-23
Family Fibronectin type III 0.000000866
Further Details:      
 
Domain Number 4 Region: 341-436
Classification Level Classification E-value
Superfamily Fibronectin type III 2.57e-19
Family Fibronectin type III 0.00000141
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003264755.1.23891
Sequence length 897
Comment PREDICTED: cytokine receptor common subunit beta isoform X2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MALAQGLLSMALLALCWQRSLAGAEETIPLQTLRCYNDYTSHITCRWADTQDAQRLVNVT
LIRRVNEDPPKAVSCDLSDDMPWSACPHPHCVPRRCVIPCQSFVVTDVDYFSFQPDRPLG
TRLTVTLTQHVQPPAPRDLKISTDQDHFLLTWSVAVWGPQSHWLSQGDLEFEVVYKRLQD
SWEDAATLLSNISQATLGPEHLMPSSTYMARVRTRLAPGSRLSGHPSKWSPEVRWDSQPG
DEAQPQNLQCFFDGAAVLSCSWEVRKEVASSVSFGLFYKPSPDAGEEECSPVLREELGSL
HTRHHCRIPVPDPTAHGQYIVSVQPRMAEKHIKSSVNIQMAPPSLNVTKDGDSYSLRWET
MKMRYEHIDHTFEIQYRKDTATWKDSKTETLQNAHSMALPALEPSTRYWARVRVRTFRTG
YNGIWSEWSEACSWDTESVLPMWVLALVVIFLTIAVLLALRFCGIYGYRLRRKWEEKIPN
PSKSHLFQNGSAELWLPGSMSAFTSGSPRHQGPWGSRFPELEGVFPVGFGDSEVSPLTIE
DPKHVCDPPSGPDTTPAASDLPTEQPLSPQPGPPAPSHTPEKQVSSFDFNGPYLGPPHSR
SLPDILGQPEPPQEGGSQKSPPPGSLEYLCLPAGGQVQLVPLAQAMGQGQAVEVERRPSQ
GAAASSSLQSGEGPAPPALGPRVGGQDQKDSPVATPTSSGDPEDPGETSAYVSSADLVFP
PHSGASSVSLVPSLGLPSDQTPSLCPGLANGPPGAPSPVKSGFEDYVELPPIEGQSPRSP
RNNPVPPEARSPVLNPGERRAAVSPTFPQPEGLLVLQQVGDYCFLPGLGPSPLSLRSKPS
SPEPCPEIRDLDQAFQVKKPPGQAVPQVPVIQLFKALKQQDYLSLPPWEVNKPGEVC
Download sequence
Identical sequences XP_003264755.1.23891 ENSNLEP00000023248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]