SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003265629.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003265629.1.23891
Domain Number 1 Region: 3-118,174-292,319-439,539-598,627-648
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.66e-39
Family Glycerol-3-phosphate transporter 0.085
Further Details:      
 
Domain Number 2 Region: 457-506
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000347
Family Ovomucoid domain III-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003265629.1.23891
Sequence length 702
Comment PREDICTED: solute carrier organic anion transporter family member 1B3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MDQHQHLNKTAESESSEKKKTRRCNGFKMFLAALSFSYIAKALGGIIMKISITQIERRFD
ISSSLAGLIDGSFEIGNLLVIVFVSYFGSKLHRPKLIGIGCLLMGTGSILTALPHFFMGY
YRYSKETHINPSENSTSSLSTCLINQTLSFNGTSPEIVEKDCVKESGSHMWIYVFMGNML
RGIGETPIVPLGISYIDDFAKEGHSSLYVGSLNAIGMIGPVIGFALGSLFAKMYVDIGYV
DLSTIRITPKDSRWVGAWWLGFLVSGLFSIISSIPFFFLPQNPNKPQKERKISLSLHVLK
TNDDRNQTANLTNQGKNVTKNVTGFFQSLKSILTNPLYVIFLLLTLLQVSSFIGSFTYVF
KYMEQQYGQSASQANFLLGTITIPMIATGMLLGGYIIKKFKLPLVGIAKFSFLTSIISFL
FQLLYFPLICESKSVAGLTLTYDGNNSVASHVDVPLSYCNSECNCDESQWEPVCGNNGIT
YLSPCLAGCKSSSGIKKHTVFYNCSCVEVTGLQNRNYSAHLGECPRDNACTRKFFIYVAI
QVINSLFSATGGTAFILLTVKIVQPELKALAMGFHSMVIRTLGGILAPIYFGALIDKTCM
KWSTNSCGAQGACRIYNSVFFGRVYLGLSIALRFPALILYIVFIFAMKKKFQGKDTKALD
NERKVMDEANLEFLNNGEHFVPSAGTDSKTCNLDMQDNAAAN
Download sequence
Identical sequences G1QXP1
XP_003265629.1.23891 ENSNLEP00000005712 ENSNLEP00000005712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]