SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003266197.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003266197.1.23891
Domain Number 1 Region: 50-313
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.56e-56
Family WD40-repeat 0.00043
Further Details:      
 
Domain Number 2 Region: 390-474
Classification Level Classification E-value
Superfamily RING/U-box 5.3e-25
Family U-box 0.0019
Further Details:      
 
Domain Number 3 Region: 330-399
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000229
Family SAM (sterile alpha motif) domain 0.037
Further Details:      
 
Weak hits

Sequence:  XP_003266197.1.23891
Domain Number - Region: 7-49
Classification Level Classification E-value
Superfamily Nitrous oxide reductase, N-terminal domain 0.0102
Family Nitrous oxide reductase, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003266197.1.23891
Sequence length 476
Comment PREDICTED: WD repeat, SAM and U-box domain-containing protein 1 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MAKLINTLADHGDDVNCCAFSFSLLATCSLDKTIRLYSLRDFTELPHSPLKFHTYAVHCC
CFSPSGHILASCSTDGTTVLWNTENGQMLAVMEQPSGSPVRVCQFSPDSTCLASGAADGT
VVLWNAQSYKLYRCGSVKDGSLAACAFSPNGSFFVTGSSCGDLTVWDDKMRCLHSEKAHD
LGITCCDFSSQPVSDGEQGLQFFRLASCGQDCQVKIWIVSFTHILGFELKYKSTLSGHCA
PVLACAFSHDGQMLVSGSVDKSVIVYDTNTENILHTLTQHTRYVTTCAFAPNTLLLATGS
MDKTVNIWQFDLETLCQARSTEDQLKQFTEDWSEEDVSTWLCAQDLKDLVGIFKMNNIDG
KELLTLTKESLADDLKIESLGLRSKVLRKIEELRTKVKSLSSGIPDEFICPITRELMKDP
VIASDGYSYEKEAMENWISKKKRTSPMTNLVLPSAVLTPNRTLKMAINRWLETHQK
Download sequence
Identical sequences G1QJZ7
ENSNLEP00000001242 XP_003266197.1.23891 ENSNLEP00000001242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]