SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003266231.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003266231.1.23891
Domain Number - Region: 218-250
Classification Level Classification E-value
Superfamily Kringle-like 0.0628
Family Kringle modules 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003266231.1.23891
Sequence length 406
Comment PREDICTED: putative sodium-coupled neutral amino acid transporter 11 isoform X2 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKQAGFPLGILLLFWVSYVTDFSLVLLIKGGALSGTDTYQSLVNKTFGFPGYLLLSVLQF
LYPFIAMISYNIIAGDTLSKVFQRIPGVDPENVFIGRHFIIGLSTVTFTLPLSLYRNIAK
LGKVSLISTGLTTLILGIVMARAISLSPHIPKTEDAWVFAKPNAIQAVGVMSFAFICHHN
SFLVYSSLEEPTVAKWSRLIHMSIVISVFICIFFATCGYLTFTGFTQGDLFENYCRNDDL
VTFGRFCYGVTVILTYPMECFVTREVIANVFFGGNLSSVFHIVVTVMVITVATLVSLMID
CLGIVLELNGVLCATPLIFIIPSACYLKLSEEPRTHSDKIMSCVMLPIGAVVMVFGFVMA
ITNPQDCTHGQEMFYCFPDNFSLTNTSESHVQQTTQLSILNISIFQ
Download sequence
Identical sequences A0A2I3HYD6
ENSNLEP00000003569 ENSNLEP00000003569 XP_003266229.1.23891 XP_003266231.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]