SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003266345.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003266345.1.23891
Domain Number 1 Region: 31-122
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000468
Family V set domains (antibody variable domain-like) 0.00000956
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003266345.1.23891
Sequence length 234
Comment PREDICTED: triggering receptor expressed on myeloid cells 1 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MRKTRLWGLLWMLFVSELRAATKLTEEKYELKEGQTLDVKCDYTLEKFASSQKAWQIIRD
GEKPKTLACTERPSENSHPVQVGRIIMEDYHDHGLLHVRMTNLLVEDSGLYQCVIYQPPK
EPHMLFHRIRLVVTKGSSGTPGSNENSTQNVYKIPPTTTKALRPLYTRPRTVTQAPPKST
TDVSTPDSEINLTNVTDIIRVPVFNIVILVAGGFLSKSLVFSVLFAVTLRSFVP
Download sequence
Identical sequences G1QYL5
ENSNLEP00000006036 ENSNLEP00000006036 XP_003266345.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]