SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003268831.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003268831.1.23891
Domain Number 1 Region: 23-128
Classification Level Classification E-value
Superfamily Immunoglobulin 5.8e-18
Family V set domains (antibody variable domain-like) 0.00000201
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003268831.1.23891
Sequence length 235
Comment PREDICTED: T-cell surface glycoprotein CD8 alpha chain isoform X3 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MSLPVTALLLPLALMLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQP
RGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSN
SIMYFSHFVPVFLPEKPTTTPAPRPPTPAATTASQPLSLRPEACRPAAGGAVHTRGLDFA
CGIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGGKPSLSERYV
Download sequence
Identical sequences G1QRH2
XP_003268831.1.23891 ENSNLEP00000003540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]