SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003268971.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003268971.1.23891
Domain Number 1 Region: 214-275
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000628
Family VWC domain 0.0074
Further Details:      
 
Weak hits

Sequence:  XP_003268971.1.23891
Domain Number - Region: 153-213
Classification Level Classification E-value
Superfamily FnI-like domain 0.00045
Family Fibronectin type I module 0.04
Further Details:      
 
Domain Number - Region: 278-323
Classification Level Classification E-value
Superfamily FnI-like domain 0.0534
Family Fibronectin type I module 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003268971.1.23891
Sequence length 325
Comment PREDICTED: brorin [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MPSSTAMAVGALSSSLLVTCCLMVALCSPSIPLEKLAQAPEQPGQEKREHASRDGPGRVN
ELGRPARDEGGSGRDWKSKSGRGLAGREPWSKLKQAWVSQDGGAKAGDLQVRPRGDTPQG
EALAAAAQDAIGPELAPTPEPPEEYVYPDYRGKGCVDESGFVYAIGEKFAPGPSACPCLC
TEEGPLCAQPECPRLHPRCIHVDTSQCCPQCKERKNYCEFRGKTYQTLEEFVVSPCERCR
CEANGEVLCTVSACPQTECVDPVYEPDQCCPICKNGPNCFAETAVIPAGREVKTDECTIC
HCTYEEGTWRIERQAMCTRHECRQM
Download sequence
Identical sequences G1QXA1
XP_003268971.1.23891 ENSNLEP00000005572 ENSNLEP00000005572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]