SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003270819.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003270819.1.23891
Domain Number 1 Region: 20-184
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.75e-46
Family Dual specificity phosphatase-like 0.0000000461
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003270819.1.23891
Sequence length 185
Comment PREDICTED: dual specificity protein phosphatase 3 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MSGSFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKIGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLAKE
GKLKP
Download sequence
Identical sequences G1R137
ENSNLEP00000006908 XP_003270819.1.23891 XP_012353160.1.23891 XP_012353161.1.23891 ENSNLEP00000006908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]