SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003270893.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003270893.1.23891
Domain Number 1 Region: 665-921
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.38e-59
Family Protein kinases, catalytic subunit 0.0000000734
Further Details:      
 
Domain Number 2 Region: 33-226
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.78e-55
Family Ephrin receptor ligand binding domain 0.0000054
Further Details:      
 
Domain Number 3 Region: 366-579
Classification Level Classification E-value
Superfamily Fibronectin type III 7.15e-33
Family Fibronectin type III 0.0000564
Further Details:      
 
Domain Number 4 Region: 945-1013
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000838
Family SAM (sterile alpha motif) domain 0.0018
Further Details:      
 
Weak hits

Sequence:  XP_003270893.1.23891
Domain Number - Region: 296-359,405-425
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000282
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003270893.1.23891
Sequence length 1019
Comment PREDICTED: ephrin type-B receptor 6 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MATEGAAQLGNRLAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVS
GGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSAAWAVG
PHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSFASF
PETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGCRCQ
PGFQPARGDRACQACPRGLYKASAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASSDPP
EAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASGGGG
TCRRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAINVS
TSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSVTLTSET
NTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGSILG
ALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIRELA
REVDPAYIKIEEVIGTGSFGEVRRGRLQPRGRREQTVAIQALWAGGAESLQMTFLGRAAV
LGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGVAAA
MQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHTTSS
DVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQKDR
ARRPYFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGL
ECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLADHQKKLLHHIQLRSATLRQQGSVEV
Download sequence
Identical sequences G1QQV9
XP_003270893.1.23891 ENSNLEP00000003327 ENSNLEP00000003327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]