SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003271324.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003271324.1.23891
Domain Number 1 Region: 37-204
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.58e-43
Family Dual specificity phosphatase-like 0.0000411
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003271324.1.23891
Sequence length 221
Comment PREDICTED: dual specificity phosphatase DUPD1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MTSGEVKTSLKNAYSSAKRLSPKMEEEGEEEDYCTPGAFELERLFWKGSPQYTHVNEVWP
KLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGPNYYRDMDIQYHGVEADDLPTFD
LSVFFYPAAAFIDRALRDDHSKILVHCVMGRSRSATLVLAYLMIHKDMTLVDAIQQVAKN
RCVLPNRGFLKQLRELDKQLVQQRRQAQCQDGEEEEDSREL
Download sequence
Identical sequences G1S4L5
ENSNLEP00000020453 ENSNLEP00000020453 XP_003271324.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]