SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003271480.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003271480.1.23891
Domain Number 1 Region: 119-323
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.42e-59
Family Myotubularin-like phosphatases 0.000019
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily PH domain-like 1.29e-19
Family GRAM domain 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003271480.1.23891
Sequence length 324
Comment PREDICTED: myotubularin-related protein 9 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MEFAELIKTPRVDNVVLHRPFYPAVEGTLCLTGHHLILSSRQDNTEELWLLHSNIDAIDK
RFVGSLGTIIIKCKDFRIIQLDIPGMEECLNIASSIEALSTLDSITLMYPFFYRPMFEVI
EDGWHSFLPEQEFELFSSATSEWRLSYVNKEFAVCPSYPPIVTVPKSIDDEALRKVATFR
HGGRFPVLSYYHKKNGMVIMRSGQPLTGTNGRRCKEDEKLINATLRAGKRGYIIDTRSLN
VAQQARAKGGGFEQEAHYPQWRRIHKSIERYHILQESLIKLVEACNDQTHNMDRWLSKLE
ASNWLTHIKEILTTACLAAQCIDR
Download sequence
Identical sequences XP_003271480.1.23891 ENSNLEP00000018268 ENSNLEP00000018268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]