SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003272073.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003272073.1.23891
Domain Number 1 Region: 436-532
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-25
Family SPRY domain 0.00084
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-20
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 306-378
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.5e-19
Family SPRY domain 0.0027
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000336
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  XP_003272073.1.23891
Domain Number - Region: 384-425
Classification Level Classification E-value
Superfamily ARM repeat 0.00115
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003272073.1.23891
Sequence length 539
Comment PREDICTED: tripartite motif-containing protein 26 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALKK
LQDQRQYIVAEFEQGHQFLREREEHLLEQLAKLEQELTEGREKFKSRGVGELARLALVIS
ELEGKAQQPAAELMQDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREF
QGKLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQFDCEPGVLGS
KGFTWGKVYWEVEVEREGWSEDEEEGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLG
DEEEEEEEEEEEVLESCMVGVARDSMKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAEL
FPALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences A0A2K5KFU6 G1QYP9 K7BAR0 Q7YR34
ENSPTRP00000039843 9598.ENSPTRP00000039843 NP_001037841.1.37143 XP_003272073.1.23891 XP_009449080.1.37143 XP_009449081.1.37143 XP_009449082.1.37143 XP_009449085.1.37143 XP_011800443.1.43180 XP_012358589.1.23891 XP_012358590.1.23891 ENSNLEP00000006070 ENSNLEP00000006070 ENSPTRP00000039843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]