SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003273211.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003273211.1.23891
Domain Number 1 Region: 92-162
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000221
Family V set domains (antibody variable domain-like) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003273211.1.23891
Sequence length 255
Comment PREDICTED: transmembrane protein 81 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKVLATSFVLGSLGLAFYLPLVVTTPKTLAIPEKLQEAVGKVIINATTCTVTCGLGYKEE
TVCEVGPDGVRRKCQTQRLECLTNWICGMLHFTILIGKEFELSCLSSDILEIGQEAFRFT
WRLARGIISTDDEVFKPFRANSHFVKFKYAQEYDSGTYRCDVQLLKNLRLVKRLYFGLRV
LPPNLVNLNFHQSLTEDQKLIDEGLEVNLDSYSKPHHPKWKKKVASALGIGIASGVVGGV
LVRIVLCVLRGGLQQ
Download sequence
Identical sequences G1S9L0
ENSNLEP00000022201 XP_003273211.1.23891 ENSNLEP00000022201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]