SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003273492.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003273492.1.23891
Domain Number 1 Region: 160-265
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000115
Family V set domains (antibody variable domain-like) 0.018
Further Details:      
 
Domain Number 2 Region: 41-159
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000511
Family V set domains (antibody variable domain-like) 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003273492.1.23891
Sequence length 342
Comment PREDICTED: signal-regulatory protein beta-2 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MCSTMSAPTCLARLLPCFLLLALVLVPSDASGQSSRNDWQVLQPEGPMLVAEGETLLLRC
MAVGSCTDGMIKWVKVRTQDQQEIYNFKHGSFPGVMPMIQRTSEPLNCDYSIYIHNVTRE
HTGTYHCVRFDDLSEHSEMKSDEGTSVLVKGAGDPEPDLWIIQPQELVLGTTGDTVFLNC
TVLGDGPPGPIRWFQGAGLSREAIYNFGGNSRPKATAVRTSNSDFSILLQNVSSEDAGTY
YCVKFQRKPNRQYLSGQGTRLKVKAKSTSSQEAEFTSEHATEMSATGLLVVFAPVVLGLK
AITLAALLLALATSRRSPGQEDVKTTGPAGAMNTLAWSKGQE
Download sequence
Identical sequences G1RDR7
ENSNLEP00000011366 XP_003273492.1.23891 ENSNLEP00000011366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]