SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003273874.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003273874.1.23891
Domain Number 1 Region: 19-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000199
Family V set domains (antibody variable domain-like) 0.0088
Further Details:      
 
Domain Number 2 Region: 147-223
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000207
Family C2 set domains 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003273874.1.23891
Sequence length 290
Comment PREDICTED: programmed cell death 1 ligand 1 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MRIFAVFIFMTYWHLLNAFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEME
DKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGG
ADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTT
TTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRSDPEENHTAELVIPELPLAHPPNERTH
LVILGAILVFLGVALTFIFCLRKGRMMDVKKCGIRDTNSKKQSDTQLEET
Download sequence
Identical sequences G1RCP1
XP_003273874.1.23891 ENSNLEP00000010990 ENSNLEP00000010990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]