SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003274142.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003274142.1.23891
Domain Number 1 Region: 78-158
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000525
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003274142.1.23891
Sequence length 233
Comment PREDICTED: LRRN4 C-terminal-like protein [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MLGSPCLLWLLAVTFLVPRAQPLAPQDFEEEEEDETETAWPPLPAVPCDYDHCRHLQVPC
KELQRAGPAACLCPGLSSPAQPPDPPRMGEVRIAAEEGRAVVHWCAPYSPVLHYWLLLWD
GSGPPLNATVRRAELKGLKPGGVYVVCVVAANEAGASRVPQAGGEGLEGADIPAFGPCSR
LAVPPNPRTLVHAAVGVGTALALLSCAALVWHFCLRDRWGCPRRAAARAAGAL
Download sequence
Identical sequences G1QVD2
ENSNLEP00000004903 ENSNLEP00000004903 XP_003274142.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]