SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003274701.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003274701.1.23891
Domain Number 1 Region: 400-618
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.23e-51
Family DBL homology domain (DH-domain) 0.00033
Further Details:      
 
Domain Number 2 Region: 609-739
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000685
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003274701.1.23891
Sequence length 841
Comment PREDICTED: rho guanine nucleotide exchange factor 15 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MSAQSLPAATPPTQKPPRIIRPRPPSRSRAAQSPGPPHNGSSPQELPRNSNDAPTPMCAP
IFWEPPAASLKPPALLPPSASRASLDSQTSPDSPSSTPTPSPVSRRSASPEPAPRSPVPP
PKPSGSPCMPLLPMAGVLAQNGSASAPGTVRRLAGRFEGGAEGRAQDADAPEPSLQVRAD
VNGEREAPLTGSGSQENGAPDAGLACPPCCPCICHTTRPGLELRWVPVGGYEEIPRVPRR
ASPLRTSRSRPNPPSIGHPAVVLTSYRSTAERKLLPPLKPPKPTRVRQDATIFGDPPEPD
LDLPSEDGIQTGDSPDEAPRNAPPATVEGREEEGLEVLKEQNWELPLQDEPLYQTYRAAV
LSEELWGVGEDGSPSPANAGDAPTFPRPPGPRNTLWQELPAVQASGLLDTLSSQERRMQE
SLFEVVTSEASYLRSLRLLTDTFVLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLATLL
SRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQS
LPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTEEGSSRQENAQKALGAVSKIIERCSA
EVGRMKQTEELIRLTQRLRFHKVKALPLVSWSRRLEFQGELTELGCRRGGVLFASRPRFT
PLCLLLFSDLLLITQPKSGQRLQVLDYAHRSLVQAQQVPDPSGPPTFRLSLLSNHQGRPT
HRLLQASSLSDMQRWLGAFPTPGPLPCSSDTIYEDCDCSQELCSESSAPAKTEGRSLESR
AAPKHLHKTPEGWLKGLPGAFPAQLVCEVTGEHERRRHLRQHQRLLEAVGPSSGTPNAPP
P
Download sequence
Identical sequences G1RG00
ENSNLEP00000012150 XP_003274701.1.23891 XP_012356801.1.23891 ENSNLEP00000012150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]