SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003275006.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003275006.1.23891
Domain Number 1 Region: 134-247
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.06e-38
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 36-132
Classification Level Classification E-value
Superfamily C-type lectin-like 1.23e-37
Family Link domain 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003275006.1.23891
Sequence length 277
Comment PREDICTED: tumor necrosis factor-inducible gene 6 protein [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MIVLIYLFLLLWEDTQGWGFKDGIFHNSIWLERAAGVYHREARSGKYKLTYAEAKAVCEF
EGGHLATYKQLEAARKIGFHVCAAGWMAKGRVGYPIVKPGPNCGFGKTGIIDYGVRLNRS
ERWDAYCYNPHAKECGGVFTDPKRIFKSPGFPNEYEDNQICYWHIRLKYGQHIHLSFLDF
DLEDDPGCLADYVEIYDSYDDVHGFVGRYCGDELPDDIISTGNVMTLKFLSDASVTAGGF
QIKYVAVDPVSKASQGKNTSTTSTGNKNFLAGRFSHL
Download sequence
Identical sequences G1RJ80
ENSNLEP00000013287 ENSNLEP00000013287 XP_003275006.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]