SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003275598.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_003275598.1.23891
Domain Number - Region: 157-194,308-391
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00033
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003275598.1.23891
Sequence length 495
Comment PREDICTED: mucin-13 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MKAITHLTLLALLFVNTASSQSSSPVVTATETATSGPTVAATDTTETNFPETASTTTNTP
SFPTATSPASPIINTHSSSTIPTPTATDSESTTNANSLATSDIITTSSTNDGLITTVHSE
TQSNNETFPTTKDNQSSGPPTGTTLLESSTLSNTVPSSPCQDDPCADNSLCVELNNTHFC
LCLEGYYYNSSTCKKGKVFPGTILVKVSETFDPEEKHSMAYQDLHREITSFFKDVFGTSV
YGQTVILTVSTPRSPRSEMRADDKVVNVTIVTILTETTSDDEKTVTTKINKATGNNSSNI
LNYNSTSRCDYYGCNQTADDCLDGLACDCKSDLQRPSPQSPFCVASSLKCPEACNAEHKQ
CLIKKNGGAPECACMPGYEEDANQNCQKCAFGYSGLDCKDKFQLILTIVGTIAGIVILSM
IIALIVTARSNNKKKDIEEENLIDEDFQNLKLQPTGFTNLGAEGSIFPKVRIAASRDSQM
QNPYASQSNMPRPDY
Download sequence
Identical sequences G1QIT6
XP_003275598.1.23891 ENSNLEP00000000830 ENSNLEP00000000830

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]