SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_003277721.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003277721.1.23891
Domain Number 1 Region: 79-147
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.06e-16
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 120-270
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000235
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 262-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000215
Family EGF-type module 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003277721.1.23891
Sequence length 439
Comment PREDICTED: fibulin-7 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MVPSSPRALFLLLLILACPEPRASQNCLSKQQLLSAIRQLQQLLKGQETRFAEGIRHMKS
RLAALQNSVSRVAPDAPPVSCPDLNTPADGRKFGSKYLVDHEVHFTCNPGFRLVGPSSVV
CLPNGTWTGEQPRCRDTSECSSQPCQNGGTCVEGVNQYRCICPPGRTGNRCQHQAQTAAP
EGSVAGDSAFSRAPRCAQVERAQHCSCEAGFHLSGAAGNSVCQDVNECELYGQEGRPRLC
MHACVNTPGSYRCTCPSGYRTLADGKSCEDVDECVGLQPVCPQGTTCINTGGSFQCVSPE
CPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATA
SAPGRAGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDR
SFQANHVSKVTIFVSPYDF
Download sequence
Identical sequences G1QLT9
XP_003277721.1.23891 ENSNLEP00000001905 ENSNLEP00000001905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]