SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003278199.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003278199.1.23891
Domain Number 1 Region: 121-158
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000314
Family Cripto EGF-like domain-like 0.0061
Further Details:      
 
Domain Number 2 Region: 88-117
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000273
Family EGF-type module 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003278199.1.23891
Sequence length 223
Comment PREDICTED: cryptic protein isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MTWRHHVRLLFTVSLALQIINLGNSYQREKHNGGREEVTKVATQKHQQSPLNWTSSHLGE
VTGSAEGWGPEEPLPYSRAFGEGAFARPRCCRNGGTCVLGSFCVCPAHFTGRYCEHDQRR
SECGALEHGAWTLRGCHLCRCIFGALHCLALQMPGRCDPKDFLASHAHGPSAGGAPSLLL
LLPCALLHRLLRPDAPAHPGSLVPSVLQRERRPCRRPGLGHRL
Download sequence
Identical sequences G1S1H8
ENSNLEP00000019366 ENSNLEP00000019366 XP_003278199.1.23891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]