SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003279670.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003279670.1.23891
Domain Number 1 Region: 63-87
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000000119
Family CCCH zinc finger 0.0046
Further Details:      
 
Domain Number 2 Region: 38-60
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000445
Family CCCH zinc finger 0.005
Further Details:      
 
Weak hits

Sequence:  XP_003279670.1.23891
Domain Number - Region: 120-142
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000196
Family CCCH zinc finger 0.0062
Further Details:      
 
Domain Number - Region: 146-172
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00114
Family CCCH zinc finger 0.0044
Further Details:      
 
Domain Number - Region: 92-117
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.089
Family CCCH zinc finger 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003279670.1.23891
Sequence length 179
Comment PREDICTED: putative cleavage and polyadenylation specificity factor subunit 4-like protein [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MQEVIAGLERFTFAFEKDVEMQKGTGLLPFQGMDKSASAVCNFFTKGLCEKGKLCPFRHD
RGEKMVVCKHWLRGLCKKGDHCKFLHQYDLTRMPECYFYSKFGDCSNKECPFLHVKPAFK
SQDCPWYDQGFCKDGPLCKYRHVPRIMCLNYLVGFCPEGPKCQFAQKIREFKLLPGSKI
Download sequence
Identical sequences G1QL67
XP_003279670.1.23891 ENSNLEP00000001680 ENSNLEP00000001680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]