SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003280880.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003280880.1.23891
Domain Number 1 Region: 30-181
Classification Level Classification E-value
Superfamily C-type lectin-like 4.89e-20
Family C-type lectin domain 0.0035
Further Details:      
 
Domain Number 2 Region: 256-382
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000133
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 3 Region: 419-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000041
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 4 Region: 381-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000837
Family EGF-type module 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003280880.1.23891
Sequence length 651
Comment PREDICTED: complement component C1q receptor [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MATPMGLLLLLLLLSQPGAGTGANTEAVVCAGTACYTAHSGKLSAAEAQNHCSQNGGNLA
TVKSEEEAQHVQRVLAQLLRREAALTARMGKFWIGLQREKGKCLDPSLPLKGFSWVGGGE
DTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCK
FSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAADVACGEGDKDKSQSHYFLCK
EKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCA
SRNPCSSSPCRGEATCILGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNT
PGGFRCECWVGYEPGGPGERTCRDVDECALDRSPCAQGCTNTEGSFHCSCEEGYVLAGED
GTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPP
DEEYKGEKEGNTILPAATASPTRGSEGTPKATPTARRPSLSSDTPITSAPLEMLAPSWSP
GVWREPSIHHATAASGPQEPAGGDSSVATQNDDGTDGQKLLLFYILGTVVAILLLLALAL
GLLVYRKRRAKRQEKKEKKPQNAADSYSWVPERVESRAMENQYSPTPGTDC
Download sequence
Identical sequences G1RLD8
XP_003280880.1.23891 ENSNLEP00000014046 ENSNLEP00000014046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]