SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003281202.1.23891 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003281202.1.23891
Domain Number 1 Region: 201-407,439-513
Classification Level Classification E-value
Superfamily RNI-like 1.96e-25
Family Rna1p (RanGAP1), N-terminal domain 0.085
Further Details:      
 
Domain Number 2 Region: 107-165
Classification Level Classification E-value
Superfamily F-box domain 0.00000000314
Family F-box domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003281202.1.23891
Sequence length 541
Comment PREDICTED: F-box/LRR-repeat protein 6 isoform X1 [Nomascus leucogenys]; AA=GCF_000146795.2; RF=representative genome; TAX=61853; STAX=61853; NAME=Nomascus leucogenys; AL=Chromosome; RT=Major
Sequence
MAAPASRQVRRRARAAPRPRSAEDWWWDRLAPRGSGYHLLQSDSMLLVLSEPGPARPRAQ
RRAARRTPRQPPPGPRAAAKPRARLRPEPAPSPAAASAPAPMPTPEEGRNAGWGDRIPLE
ILVQIFGLLVASDGPIPFLGRAARVCRRWQEAASQPALWHTVTLSSPLVGQLAKGGVKAE
KKLLASLEWLMPSRFSQLQRLTLIHWKSQVHPVLKLVGECCPRLTFLKLSGCHGVTADAL
VMLAKACCRLHSLDLQHSMVESTAVVSFLEEAGSRIRKLWLTYSSQTTAILGALLGSCCP
QLQVLEVSTGINCNSIPLQLPVEALQRGCPQLQVLRLLNLMWLPKPPGRGAAPGPGFPSL
EELCLASSTCNFVSNEVLGRLLHGSPNLRLLDLRGCARITPAGLQDLPCRELEQLHLGLY
GTSDRLTLAKEGSPQLTQKWCHTLRELDLSGQGFSEKDLEQALAAFLSTPGGSHPALCSL
NLRGTRVTPSTVSSVISSCPGLLYLNLESCRCLRRGLKRVYRGLEEVQWCLEQLLTSPSR
S
Download sequence
Identical sequences XP_003281202.1.23891 ENSNLEP00000012851 ENSNLEP00000012851

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]