SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003286544.1.95606 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003286544.1.95606
Domain Number 1 Region: 6-249
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 2.35e-89
Family Inorganic pyrophosphatase 0.000000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003286544.1.95606
Sequence length 259
Comment hypothetical protein DICPUDRAFT_94197 [Dictyostelium purpureum]; AA=GCF_000190715.1; RF=representative genome; TAX=5786; STAX=5786; NAME=Dictyostelium purpureum; strain=QSDP1; AL=Scaffold; RT=Major
Sequence
MSGVVSKQVGETGSAQYRVFFLKDGKPVSPFHDVPLWVNKSQSVVNMLVEIPRGTNAKLE
IATKEYMNPIKQDTKDGKLRFVHDKYPFNYGALPQTWENPSVLDARTNAKGDNDPLDACE
IGSAQAAIGEFKQVKVLGVFAMIDAGETDWKILCIDVNDPAASLINSEEDLEKVLPGKVN
EVYTFLRDYKIPDGKGPNQFAFDGKLQNREFAVSVIEETEHEWKSLVAGKTESPLSIENV
SLNNSKTVTADEANAKLGF
Download sequence
Identical sequences F0ZGK2
XP_003286544.1.95606 jgi|Dicpu1|94197|estExt_fgeneshDP_pm.C_730005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]