SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003309721.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003309721.1.37143
Domain Number 1 Region: 172-447
Classification Level Classification E-value
Superfamily Cysteine proteinases 2.38e-94
Family Transglutaminase core 0.000000000143
Further Details:      
 
Domain Number 2 Region: 477-653
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-62
Family Extended PAW domain 0.0000000699
Further Details:      
 
Domain Number 3 Region: 13-116
Classification Level Classification E-value
Superfamily PUG domain-like 7.72e-32
Family PUG domain 0.00000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003309721.1.37143
Sequence length 654
Comment PREDICTED: peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase isoform X4 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MAAAALGSSSGSASPAVAELCQNTPETFLEASKLLLTYADNILRNPNDEKYRSIRIGNTA
FSTRLLPVRGAVECLFEMGFEEGETHLIFPKKASVEQLQKIRDLIAIERSSRLDGSNKSH
KVKSSQQPAASTQLPTTPSSNPSGLNQHTRNRQGQSSDPPSASTVTADSAILEVLQSNIQ
HVLVYENPALQEKALACIPVQELKRKSQEKLSRARKLDKGINISDEDFLLLELLHWFKEE
FFHWVNNVLCSKCGGQTRSRDRSLLPSDDELKWGAKEVEDHYCDACQFSNRFPRYNNPEK
LLETRCGRCGEWANCFTLCCRAVGFEARYVWDYTDHVWTEVYSPSQQRWLHCDACEDVCD
KPLLYEIGWGKKLSYVIAFSKDEIVDVTWRYSCKHEEVIARRTKVKEALLRDTINGLNKQ
RQLFLSENRRKELLQRIIVELVEFISPKTPKPGELGGRISGSVAWRVARGEMGLQRKETS
FIPCENEKISKQLHLCYNIVKDRYVRVSNNNQTISGWENGVWKMESIFRKVETDWHMVYL
ARKEGSSFAYISWKFECGSVGLKVDSISIRTSSQTFQTGTIEWKLRSDTARVELTGDNSL
HSYADFSGATEVILEAELSRGDGDVAWQHTQLFRQSLNDHEENCLEIIIKFSDL
Download sequence
Identical sequences H2QM74
XP_003309721.1.37143 ENSPTRP00000025357 ENSPTRP00000025357 9598.ENSPTRP00000025357

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]