SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003309921.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003309921.1.37143
Domain Number 1 Region: 18-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.35e-70
Family Protein kinases, catalytic subunit 0.000000515
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003309921.1.37143
Sequence length 501
Comment PREDICTED: caM kinase-like vesicle-associated protein isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MPFGCVTLGDKKNYNQPSEVTDRYDLGQVIKTEEFCEIFRAKDKTTGKLHTCKKFQKRDG
RKVRKAAKNEIGILKMVKHPNILQLVDVFVTRKEYFIFLELATGREVFDWILDQGYYSER
DTSNVVRQVLEAVAYLHSLKIVHRNLKLENLVYYNRLKNSKIVISDFHLAKLENGLIKEP
CGTPEYLAPEVVGRQRYGRPVDCWAIGVIMYILLSGNPPFYEEVEEDDYENHDKNLFRKI
LAGDYEFDSPYWDDISQAAKDLVTRLMEVEQDQRITAEEAISHEWISGNAASDKNIKDGV
CAQIEKNFARAKWKKAVRVTTLMKRLRAPEQSSTAAAQSASATDTATPGAAGGATAAAAS
GATSAPEGDAARAAKSDNVAPADRSATPATDGSATPATDGSVTPATDGSITPATDGSVTP
ATDRSATPATDGRATPATEESTVPTTQSSATLATKAAATPEPAMAQPDSTAPEGATGQAP
PSSKGEEAAGYAQESQREEAS
Download sequence
Identical sequences H2QMM7
9598.ENSPTRP00000025786 XP_003309921.1.37143 XP_008970495.1.60992 ENSPTRP00000025786 ENSPTRP00000025786

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]