SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003311119.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003311119.1.37143
Domain Number 1 Region: 323-504
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-63
Family SPRY domain 0.00000588
Further Details:      
 
Domain Number 2 Region: 33-145
Classification Level Classification E-value
Superfamily Immunoglobulin 4.91e-23
Family V set domains (antibody variable domain-like) 0.00025
Further Details:      
 
Domain Number 3 Region: 161-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000003
Family C1 set domains (antibody constant domain-like) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_003311119.1.37143
Sequence length 530
Comment PREDICTED: butyrophilin subfamily 2 member A1 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MESAAALHFSRPASLLLLLLLLLSLCALVSAQFIVVGPTDPILATVGENTTLHCHLSPEK
NAEDMEVRWFRSQFSPAVFVYKGGRERTEEQMEEYRGRTTFVSKDISRGSVALVIHNITA
QENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGHEDGGIRLECISRGWYPKPLTV
WRDPYGGVVPALKEVSMPDADGLFMVTTAVIIRDKSVRNMSCSINNTLLGQKKESVIFIP
ESFMPSVSPCAVALPIIVVILMIPIAICIYWINKLQKEKKILSGEKEFERETREIAVKEL
EKERVQKEEELQVKEKLQEELRWRRTFLHAVDVVLDPDTAHPDLFLSEDRRSVRRCPFRH
LEESVPDNPERFDSQPCVLGRESFASGKHYWEVEVENVIEWTVGVCRDSVERKGEVLLIP
QNGFWTLEMHKGQYRAVSSPDRILPLKESLCRVGVFLDYEAGDVSFYNMRDRSHIYTCPR
SAFSVPVRPFFRLGCEDSPIFICPALAGANGVTVPEEGLTLHRVGTHQSL
Download sequence
Identical sequences A0A2I3TKV3
ENSPTRP00000030423 XP_003311119.1.37143

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]