SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003315496.1.37143 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003315496.1.37143
Domain Number 1 Region: 67-144
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.88e-20
Family Intermediate filament protein, coiled coil region 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_003315496.1.37143
Sequence length 295
Comment PREDICTED: keratin-like protein KRT222 isoform X1 [Pan troglodytes]; AA=GCF_000001515.7; RF=representative genome; TAX=9598; STAX=9598; NAME=Pan troglodytes; AL=Chromosome; RT=Major
Sequence
MELSQLLNEIRANYEKILTRNQIETVLSTRIQLEEDISKKMDKDEEALKAAQAELKEARR
QWHHLQVEIESLHAVERGLENSLHASEQHYQMQLQDLETVIEGLEKELQEVRRGIEKQLQ
EHEMLLNTKMRLEQEIATYRRLLEKEEIRYYGCIQGGKKDKKPTTSRVGFVLPSAIINEI
SFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQTEKVDEVIKEWEGSFFKDNP
RLRKKSVSLRFDLHLAATDEGCLETKQDNLPDIEVRLIMRRSCSIPSIKPPSTAN
Download sequence
Identical sequences H2NU70 H2RBN3
ENSPPYP00000009501 XP_003315496.1.37143 XP_009250087.1.23681 9598.ENSPTRP00000055996 9600.ENSPPYP00000009501 ENSPTRP00000055996 ENSPTRP00000055996 ENSPPYP00000009501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]