SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003325392.1.73186 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003325392.1.73186
Domain Number 1 Region: 528-792
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.45e-85
Family Protein kinases, catalytic subunit 0.0000000225
Further Details:      
 
Domain Number 2 Region: 21-204
Classification Level Classification E-value
Superfamily PH domain-like 5.32e-17
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003325392.1.73186
Sequence length 809
Comment STE/STE20/PAKA protein kinase [Puccinia graminis f. sp. tritici CRL 75-36-700-3]; AA=GCF_000149925.1; RF=representative genome; TAX=418459; STAX=5297; NAME=Puccinia graminis f. sp. tritici CRL 75-36-700-3; strain=CRL 75-36-700-3; AL=Scaffold; RT=Major
Sequence
MSFSIPFGSLIPSRPPPAPPNQQQQQQQNQQQHQQKENHLSSSSSSTSSTSPYQHHHQSF
NQRSSLHQSITSGHAPSILSKSTSSMIGSAPFPSNPSSPSLSGSNLALQPNPTTIVRRGF
AKLKEDGLRSWIWSQRWLILREQTLTFHKNETTSTAAALIFLKEITNVTRTDLRPYCLEV
ETKDKTYNLALKNDEELYGWMDDIYSRSPLMGVSNPTNFVHQVHVGFDAVSGAFTGLPEQ
WTRLLTSSAITKEDYAKNPQAVLDVLEFYTDIQKRENEEYPIGSGGHQHQQSIDTSKLDH
YHHQHQHSESTHPSPNIQNNNSQNSSNTGFSSYPSRTAPSPVIQHSESSNHSAGLGDPGQ
SSSSTNFPRINNPQPSQSRPNLVPQRVAPVAPSATPGSGGLKPLSLSSSASPRPPVQPPR
ESAKQLAPAKTQGPKPLTLGQPRPANGATTTTTTTNNNNNNTGTAKPSGNAVPAKPAASA
PPSQETNQPAQAPIKALQTVKKQEAKQNERRISSLTEAQIMAKLRTVVSPQDPNQIYAKI
KKVGQGASGSVYVAKTLATGAKVAIKQMDLKVQPRKELIVNEILVMKESQHPNIVNFLDS
FIVRDDELWVVMEFMEGGALTDVIDNNTMEEDQIASICFESCKGLQHLHNQSIIHRDIKS
DNVLLDAQGHVKITDFGFCAKLTDQKSKRATMVGTPYWMAPEVVKQKEYGAKVDIWSLGI
MAIEMIENEPPYLDEEPLKALYLIATNGTPTLKKPERLSKELKNFLAVCLCVDVKSRATA
DELIQHEFLKKSCTLAGLAPLLKFKTSSR
Download sequence
Identical sequences E3K9X8
PGTT_07225 XP_003325392.1.73186

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]