SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_003329636.1.73186 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_003329636.1.73186
Domain Number 1 Region: 18-155
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-46
Family Ran-binding domain 0.0000142
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_003329636.1.73186
Sequence length 252
Comment hypothetical protein PGTG_11386 [Puccinia graminis f. sp. tritici CRL 75-36-700-3]; AA=GCF_000149925.1; RF=representative genome; TAX=418459; STAX=5297; NAME=Puccinia graminis f. sp. tritici CRL 75-36-700-3; strain=CRL 75-36-700-3; AL=Scaffold; RT=Major
Sequence
MSQPQDEQPVTSDATLEHDPDYQPLVHLTQIETKTHEENEDVFFKLRAKLFRFDKTASEW
KERGTGELKLLQDNTTKRIRLVMRRDKTLKVCANHFITAEMVLAPNVGSDRSWVYNTTAD
VGDEGVTAETLAIRFGNSENANAFKAKFEEAQKINGGLTKEPSTTTSTDPAQPEESSTTK
KEAKEEEAAAPGSKTEEKKSSEEVAESKESAPVVQSDATAQAVVETTTSETQKDAEPSDA
AKVESKDDDKKE
Download sequence
Identical sequences E3KM69
XP_003329636.1.73186 PGTT_11386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]